SUMOhydro
Code Amino Acid Code
AAlanineAla
CCysteineCys
DAspartic AcidAsp
EGlutamic AcidGlu
FPhenylalaninePhe
GGlycineGly
HHistidineHis
IIsoleucineIle
KLysineLys
LLeucineLeu
MMethionineMet
NAsparagineAsn
PProlinePro
QGlutamineGln
RArginineArg
SSerineSer
TThreonineThr
VValineVal
WTryptophanTrp
YTyrosineTyr

Format description:

Sequences have to be represented with accepted amino acid codes    (see left). You can input a sequence with FASTA format without the FASTA header directly, and make sure all the codes in the sequence were acceptable, any numerical digits in the query sequence should either be removed or replaced by appropriate letter codes. Meanwhile, the lenth of query sequence should be shorter than 3000. An acceptable sequence was shown in the below.

Example:

MYGKIIFVLLLSAIVSISASSTTGVAMHTSTSSSVTKSYISSQTNDTHKRD

TYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPEITLIIFGVMAG

VIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSVEIENPETS