The Job of your request has been done:


 Job ID: 20170914022107
 Job Title: P6 ubiq
 Organism: S.cerevisiae
 Sequence Length: 788 Amino Acids
 Status: Done
  Your Query Sequence:
MSTNLTNIALMKRRLNKRQTDDKPDQQKMNENNSTPQSPSTSTPETSIRPTPMKRFVRPRPPTPRSLSDEKNTSETTQLH
ELITSAVNSTVTLKPDPSILSAIQTQTVLPNLVVTPAVQLRIKDENKWFGMVLCHPSSPQANVSGVLYTGNKLFIVYERE
NILNENDDLKKLIDSKVITSLTTTDFKPKNKEFKIGLYNATSNVIVIDSKLDFDEMSNLKICFKSDELASLTSLHKKMIK
FSLWPNNILFPELTEVSRYFDLFKQNFLRDIELETTDNSSSLFIVSNDKYQNQSENVLEFVEAQPNSQLIISKINDMSER
FGTNGQSKQFMIGVIPATANSVDDKLKNHFSANHVILMLNPVNVIFDNHQLLTLIFTYLNKFIMEGVVVQVYTTDLINVE
DMFKYSFSTIECFYQSIGCTLINHVHDSKEVNTTTVPISVADVEDAFENVDVEDNSLSTQRSDDDKNVEGELTVDLKKSV
IDNDVMRTEIQKLDEPPKQWVDEIDDDEKNSAKMTVDEKQDILTYLTYEEFLMNPKMIDYACRYANDVFNIKALESEKCD
LVEQAENLLLRCQSIQQTNEVLEERLENETKRQEQLSIEVSELNAECEALTKSLNDIKLDCERLNKDNLELKQVMVERTA
KLEMLENARNVSDNEEVSEDEHNEQSEGYALFSQCIEAIRTLREKYPHLYSGTDANFGNVHSLLKMLKVKIASINSICDA
GISVSENQWSAYGLCCPRTRSADSVEERMLTVNDVALMNVSVSDFSNMCYDMFVHNVFIKFFWSLSLE

 

The Detailed result:

The text format
PositionScoreDescription
===============================================================
120.015274NO
17-0.021472NO
230.062271YES  Low Confidence
280.145228YES  High Confidence
540.061378YES  Low Confidence
710.170313YES  High Confidence
940.043055NO
123-0.075538NO
127-0.058543NO
152-0.017285NO
170-0.066764NO
171-0.048412NO
176-0.113971NO
187-0.158829NO
189-0.141537NO
191-0.096036NO
194-0.143534NO
210-0.009461NO
220-0.006548NO
224-0.110005NO
236-0.200255NO
237-0.190671NO
240-0.194263NO
264-0.000163NO
2890.106761YES  Low Confidence
3130.015674NO
3280.043719NO
345-0.019951NO
347-0.028287NO
381-0.098774NO
404-0.020279NO
4290.044376NO
4660.147772YES  High Confidence
477-0.003733NO
478-0.039409NO
4920.040353NO
4980.118269YES  Low Confidence
5090.132482YES  High Confidence
5130.117644YES  Low Confidence
5190.049164NO
536-0.005521NO
5520.044650NO
5580.087769YES  Low Confidence
5910.191061YES  High Confidence
6120.078296YES  Low Confidence
6180.031070NO
626-0.004664NO
6320.054961YES  Low Confidence
6410.139221YES  High Confidence
685-0.014405NO
705-0.211685NO
708-0.205227NO
710-0.211842NO
780-0.001605NO

Legend:


LabelScore RangeSensitivity Specificity
Low[0.052 - 0.130] 52.5%90%
High(0.130 - ) 31.2%;98%

Note:

Only the score > 0.052 (i.e. specificity >= 90% ) is considered to be a positive prediction. Score range [0.052 - 0.130] corresponds to a low confidence prediction, while the prediction with a score > 0.130 should be regarded as high confidence (i.e. specificity > 98%).

Since the dataset we used was selected from the proteome of S. cerevisiae, the application of CKSAAP_UbSite should be favorable in the proteome of S. cerevisiae.