The Job of your request has been done:


 Job ID: 20170913133827
 Job Title: ss
 Organism: S.cerevisiae
 Sequence Length: 301 Amino Acids
 Status: Done
  Your Query Sequence:
HQRMKKLFWDDVPNPKNCSWAQGLNFQKPETFEHLFTKHAESVIFGPLLLEPEPISEEISVDTAWKNKDEMVPAAMVSLL
LTTPDPESSSICISDQCNSANFSGSQSTQVTCEDECQRQPSVKYATLVSNDKLVETDEEQGFIHSPVSNCISSNHSPLRQ
SFSSSSWETEAQTFFLLSDQQPTMISPQLSFSGLDELLELEGSFPEENHREKSVCYLGVTSVNRRESGVLLTGEAGILCT
FPAQCLFSDIRILQERCSHFVENNLSLGTSGENFVPYMPQFQTCSTHSHKIMENKMCDLTV

 

The Detailed result:

The text format
PositionScoreDescription
===============================================================
50.068422YES  Low Confidence
60.053571YES  Low Confidence
16-0.062319NO
28-0.037512NO
38-0.100007NO
660.130961YES  High Confidence
680.097104YES  Low Confidence
1230.009557NO
1320.030652NO
2120.073443YES  Low Confidence
2900.001277NO
2950.066328YES  Low Confidence

Legend:


LabelScore RangeSensitivity Specificity
Low[0.052 - 0.130] 52.5%90%
High(0.130 - ) 31.2%;98%

Note:

Only the score > 0.052 (i.e. specificity >= 90% ) is considered to be a positive prediction. Score range [0.052 - 0.130] corresponds to a low confidence prediction, while the prediction with a score > 0.130 should be regarded as high confidence (i.e. specificity > 98%).

Since the dataset we used was selected from the proteome of S. cerevisiae, the application of CKSAAP_UbSite should be favorable in the proteome of S. cerevisiae.