The Job of your request has been done:


 Job ID: 20170910233420
 Job Title: Zrc1
 Organism: S.cerevisiae
 Sequence Length: 504 Amino Acids
 Status: Done
  Your Query Sequence:
MGLSRQARIITLLVIDSIFFLIELITGYAVGSLALVADSFHMLNDVLSLIVALYTIRLATSPSSSANSYGWQRAEILGAL
INGVFLVALCVSIGLEAIGRIVSPPEISNAQLIVVVGSLGLLSNIVGLFLFHDHGHSHGGHSHGAVALPDDADETTSLIS
RDDSVSDLYQHPAQTRAQVIETAQEFGYGGTQLSSSLDSRAGYLAKSPNAGGHGRTGSASRRTKRGSFSRAGGHSRLGSA
NVVPPVPGQNDVLPPKASKKDDHDQDRDREQEQGSDNGKKLAGNASDAESGHTHSSPAEHGRHGGHGHSHGAMNMRGVFL
HVVGDALGNVGVISAGLVIWFCQGRWTLYFDPGVSLVITCIIFSSALPLVKSASYILMQGVPSHVSLDAVRQCIYEVPGV
DSVHELHIWQLSESTVVASVHVMIEAGRDYMVVASGIRERMHSHGIHSVTIQPEFYCEETDPQDTEACLIRCPPGQCSGD
TCCPPGVKITGPEGDEGNGHDHEH

 

The Detailed result:

The text format
PositionScoreDescription
===============================================================
2060.088973YES  Low Confidence
2240.090715YES  Low Confidence
2560.045714NO
2590.084785YES  Low Confidence
2600.096087YES  Low Confidence
2790.144355YES  High Confidence
2800.136018YES  High Confidence
371-0.041211NO
4880.072617YES  Low Confidence

Legend:


LabelScore RangeSensitivity Specificity
Low[0.052 - 0.130] 52.5%90%
High(0.130 - ) 31.2%;98%

Note:

Only the score > 0.052 (i.e. specificity >= 90% ) is considered to be a positive prediction. Score range [0.052 - 0.130] corresponds to a low confidence prediction, while the prediction with a score > 0.130 should be regarded as high confidence (i.e. specificity > 98%).

Since the dataset we used was selected from the proteome of S. cerevisiae, the application of CKSAAP_UbSite should be favorable in the proteome of S. cerevisiae.