The Job of your request has been done:


 Job ID: 20170908101114
 Job Title: SPAST WT
 Organism: Homo sapiens
 Sequence Length: 616 Amino Acids
 Status: Done
  Your Query Sequence:
MNSPGGRGKKKGSGGASNPVPPRPPPPCLAPAPPAAGPAPPPESPHKRNLYYFSYPLFVGFALLRLVAFHLGLLFVWLCQ
RFSRALMAAKRSSGAAPAPASASAPAPVPGGEAERVRVFHKQAFEYISIALRIDEDEKAGQKEQAVEWYKKGIEELEKGI
AVIVTGQGEQCERARRLQAKMMTNLVMAKDRLQLLEKMQPVLPFSKSQTDVYNDSTNLACRNGHLQSESGAVPKRKDPLT
HTSNSLPRSKTVMKTGSAGLSGHHRAPSYSGLSMVSGVKQGSGPAPTTHKGTPKTNRTNKPSTPTTATRKKKDLKNFRNV
DSNLANLIMNEIVDNGTAVKFDDIAGQDLAKQALQEIVILPSLRPELFTGLRAPARGLLLFGPPGNGKTMLAKAVAAESN
ATFFNISAASLTSKYVGEGEKLVRALFAVARELQPSIIFIDEVDSLLCERREGEHDASRRLKTEFLIEFDGVQSAGDDRV
LVMGATNRPQELDEAVLRRFIKRVYVSLPNEETRLLLLKNLLCKQGSPLTQKELAQLARMTDGYSGSDLTALAKDAALGP
IRELKPEQVKNMSASEMRNIRLSDFTESLKKIKRSVSPQTLEAYIRWNKDFGDTTV

 

The Detailed result:

The text format
PositionCKSAAPBinaryphysicochemical
property
aggregation
propensities
Final ScoreDescription
=======================================================================================
K90.40180.19720.26520.29580.0926NO
K100.39960.20730.14970.25290.0760NO
K110.39450.23690.18370.38250.1001NO
K470.41480.55030.44190.52240.3377NO
K900.49110.50570.36500.32280.3846NO
K1210.53710.64640.62980.65110.7195NO
K1380.42250.35710.25510.29200.1680NO
K1420.40790.37630.55230.20430.1829NO
K1500.40110.31640.40640.62600.2098NO
K1510.40550.38090.33960.52830.2157NO
K1580.41950.47660.57800.70060.3847NO
K1800.48860.57350.73160.76700.6509NO
K1890.53600.63560.42200.57520.6466NO
K1970.60110.47000.38560.59660.6701NO
K2060.58610.43050.69150.48420.6582NO
K2340.42840.27200.32800.18050.1301NO
K2360.46420.33300.36810.20990.2111NO
K2500.48660.31260.45700.47790.3220NO
K2540.49410.59530.60300.34870.5145NO
K2790.48730.65590.47420.16890.4403NO
K2900.47090.48140.49310.19270.3161NO
K2940.43650.47610.54050.14600.2456NO
K3000.40000.41390.29210.15780.1392NO
K3100.46510.21030.16230.20470.1203NO
K3110.47590.28290.16910.20050.1619NO
K3120.48250.27100.65110.34960.2956NO
K3150.51420.53970.73090.61690.6315NO
K3400.54700.57070.65770.57840.6816NO
K3510.55560.54830.70980.63240.7107NO
K3880.59190.67220.73560.59270.8211YES  Low Confidence
K3930.53660.38330.72980.74470.6197NO
K4140.57510.63130.56560.62850.7548YES  Low Confidence
K4210.61130.61240.43660.61380.7753YES  Low Confidence
K4620.49800.31760.33070.68100.3729NO
K5020.55350.48820.60160.44870.5970NO
K5190.58640.67470.72180.74930.8423YES  Low Confidence
K5240.58550.61590.59530.42300.7229NO
K5320.63540.63400.72880.54780.8499YES  Low Confidence
K5540.55940.53730.63810.46470.6512NO
K5650.54370.33030.28880.24980.3341NO
K5700.52220.60500.76740.48670.6615NO
K5900.52410.41030.26800.70790.4793NO
K5910.52040.36730.34500.56440.4201NO
K5930.52500.40030.25340.44760.3923NO
K6090.51970.65130.79780.45150.6855NO

Legend:


LabelScore RangeSensitivity Specificity
Low[0.725 ~ 0.851] 35.4%90%
High(0.851 ~ ) 11.1%98%

Note:

Only the score > 0.725 (i.e. specificity >= 90% ) is considered to be a positive prediction. Score range [0.725 ~ 0.851] corresponds to a low confidence prediction, while the prediction with a score > 0.851 should be regarded as high confidence (i.e. specificity > 98%).

Since the dataset we used was selected from the proteome of human, the application of hCKSAAP_UbSite should be favorable in the proteome of Human.