The Job of your request has been done:


 Job ID: 20170905171026
 Job Title: OAT 1
 Organism: S.cerevisiae
 Sequence Length: 550 Amino Acids
 Status: Done
  Your Query Sequence:
MAFNDLLQQVGGVGRFQQIQVTLVVLPLLLMASHNTLQNFTAAIPTHHCRPPADANLSKNGGLEVWLPRDRQGQPESCLR
FTSPQWGLPFLNGTEANGTGATEPCTDGWIYDNSTFPSTIVTEWDLVCSHRALRQLAQSLYMVGVLLGAMVFGYLADRLG
RRKVLILNYLQTAVSGTCAAFAPNFPIYCAFRLLSGMALAGISLNCMTLNVEWMPIHTRACVGTLIGYVYSLGQFLLAGV
AYAVPHWRHLQLLVSAPFFAFFIYSWFFIESARWHSSSGRLDLTLRALQRVARINGKREEGAKLSMEVLRASLQKELTMG
KGQASAMELLRCPTLRHLFLCLSMLWFATSFAYYGLVMDLQGFGVSIYLIQVIFGAVDLPAKLVGFLVINSLGRRPAQMA
ALLLAGICILLNGVIPQDQSIVRTSLAVLGKGCLAASFNCIFLYTGELYPTMIRQTGMGMGSTMARVGSIVSPLVSMTAE
LYPSMPLFIYGAVPVAASAVTVLLPETLGQPLPDTVQDLESRKGKQTRQQQEHQKYMVPLQASAQEKNGL

 

The Detailed result:

The text format
PositionScoreDescription
===============================================================
59-0.007773NO
163-0.095391NO
297-0.039128NO
303-0.012370NO
315-0.034514NO
321-0.018272NO
382-0.157280NO
431-0.113371NO
5230.036019NO
5250.025747NO
5350.057852YES  Low Confidence
5470.107063YES  Low Confidence

Legend:


LabelScore RangeSensitivity Specificity
Low[0.052 - 0.130] 52.5%90%
High(0.130 - ) 31.2%;98%

Note:

Only the score > 0.052 (i.e. specificity >= 90% ) is considered to be a positive prediction. Score range [0.052 - 0.130] corresponds to a low confidence prediction, while the prediction with a score > 0.130 should be regarded as high confidence (i.e. specificity > 98%).

Since the dataset we used was selected from the proteome of S. cerevisiae, the application of CKSAAP_UbSite should be favorable in the proteome of S. cerevisiae.