The Job of your request has been done:


 Job ID: 20170905143928
 Job Title: 123
 Organism: Homo sapiens
 Sequence Length: 879 Amino Acids
 Status: Done
  Your Query Sequence:
MSDIFNSPQARSKISAAFGIKPTAGQDVEELLIPKVWVPPEDPLASPSRLAKFLRENGYKVLQPRSLPENEEYETDQILP
DLAWMRQIEGAVLKPTLSLPIGDQEYFPKYYPTHRPSKEKTNAYPPDIALLKQMIYLFLQVPEANEGLKDEVTLLTQNIR
DKAYGSGTYMGQATRLVAMKEVATGRNPNKDPLKLGYTFESIAQLLDITLPVGPPGEDDKPWVPLTRVPSRMLVLTGDVD
GDFEVEDYLPKINLKSSSGLPYVGRTKGETIGEMIAISNQFLRELSTLLKQGAGTKGSNKKKLLSMLSDYWYLSCGLLFP
KAERYDKSTWLTKTRNIWSAPSPTHLMISMITWPVMSNSPNNVLNIEGCPSLYKFNPFRGGLNRIVEWILAPEEPKALVY
ADNIYIVHSNTWYSIDLEKGEANCTRQHMQAAMYYILTRGWSDNGDPMFNQTWATFAMNIAPALVVDSSCLIMNLQIKTY
GQGSGNAATFINNHLLSTLVLDQWNLMRQPRPDSEEFKSIEDKLGINFKIERSIDDIRGKLRQLVPLAQPGYLSGGVEPE
QSSPTVELDLLGWSATYSKDLGIYVPVLDKERLFCSAAYPKGVENKSLKSKVGIEQAYKVVRYEALRLVGGWNYPLLNKA
CKNNAGAARRHLEAKGFPLDEFLAEWSELSEFGEAFEGFNIKLTVTSESLAELNKPVPPKPPNVNRPVNTGGLKAVSNAL
KTGRYRNEAGLSGLVLLATARSRLQDAVKAKAEAEKLHKSKPDDPDADWFERSETLSDLLEKADIASKVAHSALVETSDA
LEAVQSTSVYTPKYPEVKNPQTASNPVVGLHLPAKRATGVQAALLGAGTSRPMGMEAPTRSKNAVKMAKRRQRQKESRQ

 

The Detailed result:

The text format
PositionCKSAAPBinaryphysicochemical
property
aggregation
propensities
Final ScoreDescription
=======================================================================================
K130.48700.43690.43770.64680.4460NO
K210.46470.47260.59770.36660.3808NO
K350.44200.44030.75530.74820.4733NO
K520.64240.67580.73820.71090.8939YES  High Confidence
K600.69170.74200.72710.70820.9415YES  High Confidence
K940.46640.50540.70350.66160.5196NO
K1090.52830.65650.71780.69820.7422YES  Low Confidence
K1180.53070.39400.25320.22570.3311NO
K1200.55520.41870.23170.34300.4273NO
K1320.49410.78780.72920.65420.7606YES  Low Confidence
K1490.45390.44720.25350.25810.2410NO
K1620.51690.62840.26530.54970.5559NO
K1800.51670.44560.39110.66420.5066NO
K1900.56390.41090.64750.16580.4796NO
K1940.59890.78190.65120.54660.8570YES  High Confidence
K2200.49150.48000.64420.38720.4572NO
K2510.47660.50760.67650.57780.5088NO
K2550.55480.61050.25760.40140.5763NO
K2670.53720.44100.33190.29160.4177NO
K2900.52080.61530.69420.51330.6516NO
K2960.47950.40550.38910.24130.2854NO
K3000.46200.27120.24680.14940.1438NO
K3010.47980.35390.17120.20880.2005NO
K3020.44810.28240.69970.42790.2754NO
K3210.55170.44860.40120.43840.5166NO
K3270.56850.42560.69260.65070.6669NO
K3330.54020.65560.69280.66490.7465YES  Low Confidence
K3740.56220.83320.74020.79340.8937YES  High Confidence
K3960.53170.58660.73240.59410.6857NO
K4190.45320.31650.27810.26090.1860NO
K4780.50320.56800.55970.61480.5827NO
K5180.51640.42340.75230.57250.5574NO
K5230.50340.64130.69450.59780.6576NO
K5290.55210.55960.61770.68880.7050NO
K5400.63350.49390.28390.71470.7492YES  Low Confidence
K5790.55000.69730.74100.63420.7863YES  Low Confidence
K5900.57230.55470.55890.62960.7093NO
K6010.51770.43170.60480.39100.4710NO
K6060.53410.43440.69460.37410.5257NO
K6090.55280.30760.28600.24600.3339NO
K6110.53280.52370.40700.32060.4904NO
K6190.53060.56560.66590.73760.6958NO
K6390.54340.66570.28350.63120.6615NO
K6420.52290.51070.47820.30910.4753NO
K6550.57300.61280.74720.67990.7894YES  Low Confidence
K6820.46850.44490.46440.64830.4204NO
K6950.42320.54250.74030.38370.3836NO
K7000.45050.58880.49090.17100.3300NO
K7140.58950.64110.65490.45980.7626YES  Low Confidence
K7210.57630.57390.60720.45250.6932NO
K7490.43650.23380.28470.28760.1376NO
K7510.43440.43050.26490.20050.1924NO
K7560.42110.31720.55480.23880.1836NO
K7590.42650.33180.21330.20150.1373NO
K7610.41760.28250.34880.20280.1308NO
K7820.52000.46370.40060.56420.4968NO
K7880.44920.46360.53040.52900.3746NO
K8130.43270.47470.64870.40320.3430NO
K8180.45670.34100.34420.21340.2016NO
K8350.45290.35240.29960.48060.2553NO
K8620.46130.49130.24400.26090.2728NO
K8660.41500.46840.51990.37660.2732NO
K8690.40370.50650.38730.47010.2697NO
K8750.39670.45660.23290.30500.1727NO

Legend:


LabelScore RangeSensitivity Specificity
Low[0.725 ~ 0.851] 35.4%90%
High(0.851 ~ ) 11.1%98%

Note:

Only the score > 0.725 (i.e. specificity >= 90% ) is considered to be a positive prediction. Score range [0.725 ~ 0.851] corresponds to a low confidence prediction, while the prediction with a score > 0.851 should be regarded as high confidence (i.e. specificity > 98%).

Since the dataset we used was selected from the proteome of human, the application of hCKSAAP_UbSite should be favorable in the proteome of Human.