The Job of your request has been done:


 Job ID: 20170824000958
 Job Title: 18
 Organism: S.cerevisiae
 Sequence Length: 339 Amino Acids
 Status: Done
  Your Query Sequence:
MNWTRGKTLGRGSTATVSAATCHESGETLAVKSAEFHRSEFLQREAKILSSLNSPYVIGYRGCEITREPFHNNGEATTYS
LLMEYAPYGTLTDVATKNGGFIDEARVVKYTRQILLGLEYIHNSKGIAHCDIKGSNVLVGENGEAKIADFGCAKWVEPEI
TEPVRGTPAFMAPEAARGERQGKESDIWAVGCTVIEMVTGSQPWIGADFTDPVSVLYRVGYLGELPELPCSLTEQAKDFL
GKCLKKEATERWTASQLLNHPFLVNKEPELVTGLVTNSPTSVTDQMFWRSVEEEVSEDRSSWWECHEDERIGVLSWIGHV
VVESTWDLDGEDWITVRRN

 

The Detailed result:

The text format
PositionScoreDescription
===============================================================
70.084071YES  Low Confidence
320.079066YES  Low Confidence
47-0.032745NO
970.000055NO
109-0.160708NO
125-0.204915NO
133-0.062697NO
1460.060142YES  Low Confidence
1540.090442YES  Low Confidence
1830.087994YES  Low Confidence
237-0.055898NO
242-0.103583NO
245-0.116936NO
246-0.102121NO
2660.034831NO

Legend:


LabelScore RangeSensitivity Specificity
Low[0.052 - 0.130] 52.5%90%
High(0.130 - ) 31.2%;98%

Note:

Only the score > 0.052 (i.e. specificity >= 90% ) is considered to be a positive prediction. Score range [0.052 - 0.130] corresponds to a low confidence prediction, while the prediction with a score > 0.130 should be regarded as high confidence (i.e. specificity > 98%).

Since the dataset we used was selected from the proteome of S. cerevisiae, the application of CKSAAP_UbSite should be favorable in the proteome of S. cerevisiae.